Web Analysis for Financialservicesindustry - financialservicesindustry.org
Financial Services 101: An Introduction to the Financial Industry, The Future of Financial Services, Insider’s Guide to the Financial Services Industry, Interviewing Skills for the Financial Services Industry
financialservicesindustry.org is 6 years 10 months old. It is a domain having org extension. This website is estimated worth of $ 8.95 and have a daily income of around $ 0.15. As no active threats were reported recently by users, financialservicesindustry.org is SAFE to browse.
PageSpeed Score
Siteadvisor Rating
Traffic Report
Daily Unique Visitors: | Not Applicable |
Daily Pageviews: | Not Applicable |
Estimated Valuation
Income Per Day: | $ 0.15 |
Estimated Worth: | $ 8.95 |
Search Engine Indexes
Google Indexed Pages: | Not Applicable |
Bing Indexed Pages: | Not Applicable |
Search Engine Backlinks
Google Backlinks: | Not Applicable |
Bing Backlinks: | Not Applicable |
Safety Information
Google Safe Browsing: | No Risk Issues |
Siteadvisor Rating: | Not Applicable |
WOT Trustworthiness: | Not Applicable |
WOT Child Safety: | Not Applicable |
Website Ranks & Scores
Alexa Rank: | Not Applicable |
Domain Authority: | Not Applicable |
Web Server Information
Page Resources Breakdown
Homepage Links Analysis
Website Inpage Analysis
H1 Headings: | 5 | H2 Headings: | 70 |
H3 Headings: | 118 | H4 Headings: | Not Applicable |
H5 Headings: | Not Applicable | H6 Headings: | Not Applicable |
Total IFRAMEs: | 4 | Total Images: | 274 |
Google Adsense: | Not Applicable | Google Analytics: | UA-1177289-31 |
Websites Hosted on Same IP (i.e. 195.149.84.100)
The Blog Templates
The Blog Templates on WN Network delivers the latest Videos and Editable pages for News & Events, including Entertainment, Music, Sports, Science and more, Sign up and share your playlists.
Sound Frequency
Sound frequency on WN Network delivers the latest Videos and Editable pages for News & Events, including Entertainment, Music, Sports, Science and more, Sign up and share your playlists.
Post Free Advert
Where Should You Post Your Webcomic? - 100 Days Of Making Comics - DAY 29, Explicación escenas post-créditos: Far From Home, Relatable Everyday Girls Problems In Comics, (Undertale Comics mix) Я люблю тебя, Фриск! (Франс) | Русский дубляж [RUS]
Pune Team
Pune Top 10 Tourist Places In Hindi | Pune Tourism | Maharashtra, Pune City || 2019 || Maharashtra || Facts & Views || India || Debdut YouTube, Pune (India) - my work trip to an amazing place, PUNE City Full View (2019) Within 5 Minutes | Plenty Facts|Pune City Tour 2019| Pune |Pune City 2019
Zoosex forum
Zoosexuality, Roundabout Zoo - Sex On Fire, elephant sex in miami zoo, Big asian nipples puppy training video kim ass facesitting tubes sexual desire disorder, Sex mit Tieren soll enttabuisiert werden | 07.05.2016 | kla.tv
HTTP Header Analysis
Server: nginx
Date: Thu, 15 Jun 2017 23:28:34 GMT
Content-Type: text/html; charset=utf-8
Transfer-Encoding: chunked
Connection: keep-alive
Vary: User-Agent
Cache-Control: must-revalidate
Content-Encoding: gzip
Domain Information
Domain Nameserver Information
Host | IP Address | Country | |
---|---|---|---|
redbusprimarydns.wn.com | 195.149.84.231 | Singapore | |
redbussecondarydns.wn.com | 195.149.84.232 | Singapore |
DNS Record Analysis
Host | Type | TTL | Extra |
---|---|---|---|
financialservicesindustry.org | A | 899 |
IP: 195.149.84.101 |
financialservicesindustry.org | A | 899 |
IP: 195.149.84.100 |
financialservicesindustry.org | NS | 899 |
Target: redbusprimarydns.financialservicesindustry.org |
financialservicesindustry.org | NS | 899 |
Target: redbussecondarydns.financialservicesindustry.org |
financialservicesindustry.org | SOA | 899 |
MNAME: redbusprimarydns.financialservicesindustry.org RNAME: root.wn.com Serial: 198358287 Refresh: 7200 Retry: 900 Expire: 604800 Minimum TTL: 900 |
financialservicesindustry.org | AAAA | 899 |
IPV6: 2001:67c:38c::65 |
financialservicesindustry.org | AAAA | 899 |
IPV6: 2001:67c:38c::64 |
Full WHOIS Lookup
Registry Domain ID: D402200000002726055-LROR
Registrar WHOIS Server:
Registrar URL: http://www.enom.com
Updated Date: 2017-06-14T22:12:53Z
Creation Date: 2017-06-14T22:12:52Z
Registry Expiry Date: 2019-06-14T22:12:52Z
Registrar Registration Expiration Date:
Registrar: eNom, Inc.
Registrar IANA ID: 48
Registrar Abuse Contact Email:
Registrar Abuse Contact Phone:
Reseller:
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Domain Status: serverTransferProhibited https://icann.org/epp#serverTransferProhibited
Domain Status: addPeriod https://icann.org/epp#addPeriod
Registry Registrant ID: C180010969-LROR
Registrant Name: Dharshinee Naidu
Registrant Organization: -
Registrant Street: 174 West 4th Street
Registrant Street: Suite 160
Registrant City: New York
Registrant State/Province: NY
Registrant Postal Code: 10014
Registrant Country: US
Registrant Phone: +1.6464039833
Registrant Phone Ext:
Registrant Fax: +1.6464039833
Registrant Fax Ext:
Registrant Email: creativedreams247@gmail.com
Registry Admin ID: C180010969-LROR
Admin Name: Dharshinee Naidu
Admin Organization: -
Admin Street: 174 West 4th Street
Admin Street: Suite 160
Admin City: New York
Admin State/Province: NY
Admin Postal Code: 10014
Admin Country: US
Admin Phone: +1.6464039833
Admin Phone Ext:
Admin Fax: +1.6464039833
Admin Fax Ext:
Admin Email: creativedreams247@gmail.com
Registry Tech ID: C180010969-LROR
Tech Name: Dharshinee Naidu
Tech Organization: -
Tech Street: 174 West 4th Street
Tech Street: Suite 160
Tech City: New York
Tech State/Province: NY
Tech Postal Code: 10014
Tech Country: US
Tech Phone: +1.6464039833
Tech Phone Ext:
Tech Fax: +1.6464039833
Tech Fax Ext:
Tech Email: creativedreams247@gmail.com
Name Server: REDBUSPRIMARYDNS.WN.COM
Name Server: REDBUSSECONDARYDNS.WN.COM
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of WHOIS database: 2017-06-15T23:28:00Z